Protein Info for OHPLBJKB_01813 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Regulatory protein SdiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03472: Autoind_bind
  • amino acids 23 to 160 (138 residues), 124.9 bits, E=2e-40
• PF00196: GerE
  • amino acids 179 to 234 (56 residues), 80.2 bits, E=6.7e-27

Best Hits

Swiss-Prot: 98% identical to SDIA_ECOLI: Regulatory protein SdiA (sdiA) from Escherichia coli (strain K12)

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 98% identity to eco:b1916)

Predicted SEED Role

"N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional activator @ N-3-oxooctanoyl-L-homoserine lactone quorum-sensing transcriptional activator"

Protein Sequence (240 amino acids)

>OHPLBJKB_01813 Regulatory protein SdiA (Escherichia coli HS(pFamp)R (ATCC 700891))
MQDTDFFSWRRTMLLRFQRMEAAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFY
TNYPEAWVSYYQAKNFLAIDPVLNPENFSQGHLMWNDDLFSEAQPLWEAARAHGLRRGVT
QYLMLPNRALGFLSFSRSSAREIPILSDELQLKMQLLVRESLMALMRLNDEIVMTPEMNF
SKREKEILKWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI