Protein Info for OHPLBJKB_01721 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: HTH-type transcriptional regulator cbl

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00126: HTH_1
  • amino acids 3 to 63 (61 residues), 47.1 bits, E=1.8e-16
• PF03466: LysR_substrate
  • amino acids 90 to 293 (204 residues), 151 bits, E=3.1e-48

Best Hits

Swiss-Prot: 99% identical to CBL_ECOLI: HTH-type transcriptional regulator cbl (cbl) from Escherichia coli (strain K12)

KEGG orthology group: K13635, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 99% identity to eco:b1987)

MetaCyc: 43% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Alkanesulfonate utilization operon LysR-family regulator CbI" in subsystem DNA-binding regulatory proteins, strays

Protein Sequence (316 amino acids)

>OHPLBJKB_01721 HTH-type transcriptional regulator cbl (Escherichia coli HS(pFamp)R (ATCC 700891))
MNFQQLKIIREAARQDYNLTEVANMLFTSQSGVSRHIRELEDELGIEIFVRRGKRLLGMT
EPGKALLVIAERILNEASNVRRLADLFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFP
EVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPLDHPLTQ
ITPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLAYIVLSAQDSDVIKTYVALGLGI
GLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDI
KRQVMENSEEEIDYQI