Protein Info for OHPLBJKB_01673 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: D-inositol-3-phosphate glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 PF13439: Glyco_transf_4" amino acids 15 to 170 (156 residues), 75.5 bits, see alignment E=1e-24 PF13579: Glyco_trans_4_4" amino acids 16 to 170 (155 residues), 54.1 bits, see alignment E=4.7e-18 PF00534: Glycos_transf_1" amino acids 190 to 345 (156 residues), 110.5 bits, see alignment E=1.3e-35 PF13692: Glyco_trans_1_4" amino acids 195 to 331 (137 residues), 77.8 bits, see alignment E=2e-25

Best Hits

KEGG orthology group: K12995, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to ecx:EcHS_A2166)

Predicted SEED Role

"Glycosyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>OHPLBJKB_01673 D-inositol-3-phosphate glycosyltransferase (Escherichia coli HS(pFamp)R (ATCC 700891))
MRVLHVYKTYYPDTYGGIEQVIYQLSQGCARRGIAADVFTFSPDKETGPVAYEDHRVIYN
KQLFEIASTPFSLKALKRFKQIKDDYDIINYHFPFPFMDMLHLSARPDARTVVTYHSDIV
KQKRLMKLYQPLQERFLASVDCIVASSPNYVASSQTLKKYQDKTVVIPFGLEQHDVQHDP
QRVAHWRETVGDNFFLFVGAFRYYKGLHILLDAAERSRLPVVIVGGGPLEAEVRREAQQR
GLSNVVFTGMLNDEDKYILFQLCRGVVFPSHLRSEAFGITLLEGARFARPLISCEIGTGT
SFINQDKVSGCVIPPNDSQALVEAMNELWNNEETSNRYGENSRRRFEEMFTADHMIDAYV
NLYTTLLESKS