Protein Info for OHPLBJKB_01666 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Mannose-1-phosphate guanylyltransferase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 TIGR01479: mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase" amino acids 2 to 470 (469 residues), 737.5 bits, see alignment E=3.2e-226 PF00483: NTP_transferase" amino acids 4 to 287 (284 residues), 228.7 bits, see alignment E=1.7e-71 PF12804: NTP_transf_3" amino acids 5 to 131 (127 residues), 30.5 bits, see alignment E=7.7e-11 PF01050: MannoseP_isomer" amino acids 316 to 466 (151 residues), 217.5 bits, see alignment E=1.7e-68 PF07883: Cupin_2" amino acids 382 to 450 (69 residues), 45.5 bits, see alignment E=1e-15

Best Hits

Swiss-Prot: 97% identical to MANC9_ECOLX: Mannose-1-phosphate guanylyltransferase (manC) from Escherichia coli

KEGG orthology group: K00971, mannose-1-phosphate guanylyltransferase [EC: 2.7.7.22] (inferred from 100% identity to ecx:EcHS_A2173)

MetaCyc: 61% identical to mannose-1-phosphate guanylyltransferase (Escherichia coli K-12 substr. MG1655)
Mannose-1-phosphate guanylyltransferase. [EC: 2.7.7.13]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.13 or 2.7.7.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>OHPLBJKB_01666 Mannose-1-phosphate guanylyltransferase 1 (Escherichia coli HS(pFamp)R (ATCC 700891))
MLLPVIMAGGTGSRLWPMSRELYPKQFLRLFGQNSMLQETIIRLSGLEIHEPMVICNEEH
RFLVAEQLRQLNKLSNNIILEPVGRNTAPAIALAALQATRYGDDPLMLVLAADHIINNQS
AFHDAIRVAEQYADEGHLVTFGIVPNAPETGYGYIQRGVALTDSAHAPYQVARFVEKPDR
ERAEVYLASGEYYWNSGMFMFRAKKYLSELAKYRPDILETCQAAVNAADNGSDFINIPHD
IFCECPDESVDYAVMEKTADAVVVGLDADWSDVGSWSALWEVSPKDGQGNVLSGDAWVHN
SENCYINSDEKLVAAIGVENLVIVSTKDAVLVMNRERSQDVKKAVEFLKQNQRSEYKRHR
EIYRPWGRCDVVVQTPRFNVNRITVKPGGAFSMQMHHHRAEHWVILAGTGQVTVNGKQFL
LSENQSTFIPIGAEHCLENPGCIPLEVLEIQSGSYLGEDDIIRIKDQYGRC