Protein Info for OHPLBJKB_01664 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: UDP-glucose 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 1 to 378 (378 residues), 345.6 bits, E=1.8e-107
• PF03721: UDPG_MGDP_dh_N
  • amino acids 1 to 168 (168 residues), 117 bits, E=1.2e-37
• PF00984: UDPG_MGDP_dh
  • amino acids 192 to 281 (90 residues), 92.4 bits, E=2.4e-30
• PF03720: UDPG_MGDP_dh_C
  • amino acids 301 to 375 (75 residues), 34.6 bits, E=3.2e-12

Best Hits

Swiss-Prot: 90% identical to UDG8_ECOLX: UDP-glucose 6-dehydrogenase (ugd) from Escherichia coli

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 99% identity to kpn:KPN_02493)

MetaCyc: 83% identical to UDP-glucose 6-dehydrogenase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose 6-dehydrogenase (EC 1.1.1.22)" (EC 1.1.1.22)

MetaCyc Pathways

• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• colanic acid building blocks biosynthesis (8/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Protein Sequence (388 amino acids)

>OHPLBJKB_01664 UDP-glucose 6-dehydrogenase (Escherichia coli HS(pFamp)R (ATCC 700891))
MKITISGTGYVGLSNGVLIAQNHEVVALDIVQAKVDMLNQKISPIVDKEIQEYLAEKPLN
FRATTDKHDAYRNADYVIIATPTDYDPKTNYFNTSTVEAVIRDVTEINPNAVMIIKSTIP
VGFTRDIKERLGIDNVIFSPEFLREGRALYDNLHPSRIVIGERSARAERFADLLKEGAIK
QDIPTLFTDSTEAEAIKLFANTYLALRVAYFNELDSYAESQGLNSKQIIEGVCLDPRIGN
HYNNPSFGYGGYCLPKDTKQLLANYESVPNNIIAAIVDANRTRKDFIADSILARKPKVVG
VYRLIMKSGSDNFRASSIQGIMKRIKAKGIPVIIYEPVMQEDEFFNSRVVRDLDTFKQEA
DVIISNRMAEELADVADKVYTRDLFGND