Protein Info for OHPLBJKB_01604 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Nickel/cobalt efflux system RcnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 205 to 230 (26 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details PF03824: NicO" amino acids 13 to 273 (261 residues), 233.7 bits, see alignment E=2.9e-73 PF13386: DsbD_2" amino acids 154 to 240 (87 residues), 30.5 bits, see alignment E=3.3e-11

Best Hits

Swiss-Prot: 100% identical to RCNA_ECOHS: Nickel/cobalt efflux system RcnA (rcnA) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K08970, nickel/cobalt exporter (inferred from 100% identity to eco:b2106)

MetaCyc: 100% identical to Ni2+/Co2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-584; TRANS-RXN0-585

Predicted SEED Role

"Nickel/cobalt efflux transporter RcnA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>OHPLBJKB_01604 Nickel/cobalt efflux system RcnA (Escherichia coli HS(pFamp)R (ATCC 700891))
MTEFTTLLQQGNAWFFIPSVILLGALHGLEPGHSKTMMAAFIIAIKGTIKQAVMLGLAAT
ISHTAVVWLIAFGGMVISKRFTAQSAEPWLQLISAVIIISTAFWMFWRTWRGERNWLENM
HGHDYEHHHHDHEHHHDHGHHHHHEHGEYQDAHARAHANDIKRRFDGREVTNWQILLFGL
TGGLIPCPAAITVLLICIQLKALTLGATLVVSFSIGLALTLVTVGVGAAISVQQVAKRWS
GFNTLAKRAPYFSSLLIGLVGVYMGVHGFMGIMR