Protein Info for OHPLBJKB_01580 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Glycine betaine uptake system permease protein YehY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 48 to 65 (18 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 319 to 320 (2 residues), see Phobius details amino acids 322 to 347 (26 residues), see Phobius details amino acids 353 to 379 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 195 to 376 (182 residues), 91.8 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 100% identical to YEHY_ECOLI: Glycine betaine uptake system permease protein YehY (yehY) from Escherichia coli (strain K12)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to eco:b2130)

MetaCyc: 100% identical to glycine betaine ABC transporter membrane subunit YehY (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"Osmoprotectant ABC transporter permease protein YehY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>OHPLBJKB_01580 Glycine betaine uptake system permease protein YehY (Escherichia coli HS(pFamp)R (ATCC 700891))
MTYFRINPVLALLLLLTAIAAALPFISYAPNRLVSGEGRHLWQLWPQTIWMLVGVGCAWL
TACFIPGKKGSICALILAQFVFVLLVWGAGKAATQLAQNGSALARTSLGSGFWLAAALAL
LACSDAIRRISTHPLWRWLLHMQIAIIPLWLLYSGTLNDLSLMKEYANRQDVFDDALAQH
LTLLFGAVLPALVIGVPLGIWCYFSTARQGAIFSLLNVIQTVPSVALFGLLIAPLAALVT
AFPWLGKLGIAGTGMTPALIALVLYALLPLVRGVVVGLNQIPRDVLESARAMGMSGARRF
LHVQLPLALPVFLRSLRVVMVQTVGMAVIAALIGAGGFGALVFQGLLSSAIDLVLLGVIP
VIVLAVLTDALFDLLIALLKVKRND