Protein Info for OHPLBJKB_01534 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00877: NLPC_P60" amino acids 79 to 183 (105 residues), 128.3 bits, see alignment E=5.8e-42

Best Hits

Swiss-Prot: 100% identical to MEPS_SHIFL: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase (mepS) from Shigella flexneri

KEGG orthology group: K13694, lipoprotein Spr (inferred from 100% identity to eco:b2175)

MetaCyc: 100% identical to peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]

Predicted SEED Role

"Lipoprotein spr precursor"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.13

Use Curated BLAST to search for 3.4.17.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>OHPLBJKB_01534 Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase (Escherichia coli HS(pFamp)R (ATCC 700891))
MVKSQPILRYILRGIPAIAVAVLLSACSANNTAKNMHPETRAVGSETSSLQASQDEFENL
VRNVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQFGLELPRSTYEQQEM
GKSVSRSNLRTGDLVLFRAGSTGRHVGIYIGNNQFVHASTSSGVIISSMNEPYWKKRYNE
ARRVLSRS