Protein Info for OHPLBJKB_01510 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cytochrome c biogenesis ATP-binding export protein CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01189: heme ABC exporter, ATP-binding protein CcmA
  • amino acids 2 to 198 (197 residues), 287.5 bits, E=2.5e-90
• PF00005: ABC_tran
  • amino acids 18 to 154 (137 residues), 126.9 bits, E=9.3e-41

Best Hits

Swiss-Prot: 100% identical to CCMA_ECOL5: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 100% identity to eco:b2201)

MetaCyc: 100% identical to cytochrome c maturation protein A (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (11/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Protein Sequence (205 amino acids)

>OHPLBJKB_01510 Cytochrome c biogenesis ATP-binding export protein CcmA (Escherichia coli HS(pFamp)R (ATCC 700891))
MLEARELLCERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLW
QGQPLHQVRDSYHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAGLAGFE
DIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGIVI
LTTHQPLNVAESKIRRISLTQTRAA