Protein Info for OHPLBJKB_01436 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF12450: vWF_A" amino acids 101 to 199 (99 residues), 111 bits, see alignment E=5.5e-36 PF13768: VWA_3" amino acids 216 to 374 (159 residues), 47.5 bits, see alignment E=5.1e-16 PF00092: VWA" amino acids 216 to 383 (168 residues), 79.6 bits, see alignment E=8.5e-26 PF13519: VWA_2" amino acids 217 to 321 (105 residues), 49.3 bits, see alignment E=1.8e-16 PF12034: YfbK_C" amino acids 393 to 568 (176 residues), 223.4 bits, see alignment E=6.1e-70

Best Hits

Swiss-Prot: 100% identical to YFBK_ECOLI: Uncharacterized protein YfbK (yfbK) from Escherichia coli (strain K12)

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to eco:b2270)

Predicted SEED Role

"FIG00637883: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>OHPLBJKB_01436 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MRNKNIIMLLMSSLILSGCGPQPENKESQQQQPSTPTEQQVLAAQQAAIKEAEQSAAAAK
ALAQQEVQQYSDKQALQGRLQEAPTFARAAKAKATHIANPGTARYQQFDDNPVKQVAQNP
LATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDWDIKDKQSIPASKPIPF
AMRYELAPAPWNEQRTLLKVDILAKDRKSEELPASNLVFLIDTSGSMISDERLPLIQSSL
KLLVKELREQDNIAIVTYAGDSRIALPSISGSHKAEINAAIDSLDAEGSTNGGAGLELAY
QQATKGFIKGGINRILLATDGDFNVGIDDPKSIESMVKKQRESGVTLSTFGVGNSNYNEA
MMVRIADVGNGNYSYIDTLSEAQKVLNSEMRQMLITVAKDVKAQIEFNPAWVTEYRQIGY
EKRQLRVEHFNNDNVDAGDIGAGKHITLLFELTLNGQKASIDKLRYAPDNKLAKSDKTKE
LAWLKIRWKYPQGKESQLVEFPLGPTINAPSEDMRFRAAVAAYGQKLRGSEYLNNTSWQQ
IKQWAQQAKGEDPQGYRAEFIRLIELADGVTDISQ