Protein Info for OHPLBJKB_01404 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Glutathione S-transferase YfcF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF02798: GST_N" amino acids 13 to 80 (68 residues), 46.1 bits, see alignment E=1e-15 PF13417: GST_N_3" amino acids 15 to 86 (72 residues), 47.8 bits, see alignment E=3e-16 PF13409: GST_N_2" amino acids 15 to 82 (68 residues), 50 bits, see alignment E=7.3e-17 PF14834: GST_C_4" amino acids 95 to 211 (117 residues), 245.5 bits, see alignment E=1.7e-77

Best Hits

Swiss-Prot: 100% identical to YFCF_ECOLI: Glutathione S-transferase YfcF (yfcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2301)

MetaCyc: 100% identical to glutathione S-transferase YfcF (Escherichia coli K-12 substr. MG1655)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Probable glutathione S-transferase (EC 2.5.1.18), YfcF homolog" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>OHPLBJKB_01404 Glutathione S-transferase YfcF (Escherichia coli HS(pFamp)R (ATCC 700891))
MSKPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDLDSGEHLQPTWQGYGQTRRVP
LLQIDDFELSESSAIVEYLEDRFAPPTWERIYPLDLENRARARQIQAWLRSDLMPIREER
PTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNLFGEWCIADTDLALMINRLVL
HGDEVPERLVDYATFQWQRASVQRFIALSAKQSG