Protein Info for OHPLBJKB_01360 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative phospholipid-binding lipoprotein MlaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04333: MlaA
  • amino acids 29 to 222 (194 residues), 222.6 bits, E=2e-70

Best Hits

Swiss-Prot: 100% identical to MLAA_ECOLI: Intermembrane phospholipid transport system lipoprotein MlaA (mlaA) from Escherichia coli (strain K12)

KEGG orthology group: K04754, lipoprotein (inferred from 100% identity to eco:b2346)

Predicted SEED Role

"Lipoprotein"

Protein Sequence (251 amino acids)

>OHPLBJKB_01360 putative phospholipid-binding lipoprotein MlaA (Escherichia coli HS(pFamp)R (ATCC 700891))
MKLRLSALALGTTLLVGCASSGTDQQGRSDPLEGFNRTMYNFNFNVLDPYIVRPVAVAWR
DYVPQPARNGLSNFTGNLEEPAVMVNYFLQGDPYQGMVHFTRFFLNTILGMGGFIDVAGM
ANPKLQRTEPHRFGSTLGHYGVGYGPYVQLPFYGSFTLRDDGGDMADGLYPVLSWLTWPM
SVGKWTLEGIETRAQLLDSDGLLRQSSDPYIMVREAYFQRHDFIANGGELKPQENPNAQA
IQDDLKDIDSE