Protein Info for OHPLBJKB_01314 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 37 to 54 (18 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 279 to 304 (26 residues), see Phobius details PF13593: SBF_like" amino acids 8 to 316 (309 residues), 387 bits, see alignment E=7.2e-120 PF01758: SBF" amino acids 72 to 215 (144 residues), 33 bits, see alignment E=4.8e-12

Best Hits

Swiss-Prot: 100% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 100% identity to eco:b2410)

Predicted SEED Role

"Putative cytochrome oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>OHPLBJKB_01314 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MKLFRILDPFTLTLITVVLLASFFPARGDFVPFFENLTTAAIALLFFMHGAKLSREAIIA
GGGHWRLHLWVMCSTFVLFPILGVLFAWWKPVNVDPMLYSGFLYLCILPATVQSAIAFTS
MAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNVHGAGGSLEQVGKIMLQLLLPFVLGHL
SRPWIGDWVSRNKKWIAKTDQTSILLVVYTAFSEAVVNGIWHKVGWGSLLFIVVVSCVLL
AIVIVVNVFMARRLSFNKADEITIVFCGSKKSLANGIPMANILFPTSVIGMMVLPLMIFH
QIQLMVCAVLARRYKRQTEQLQAQQESSADKA