Protein Info for OHPLBJKB_01302 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cysteine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01138: cysteine synthase B
  • amino acids 3 to 292 (290 residues), 562.2 bits, E=2.7e-173
• TIGR01136: cysteine synthase
  • amino acids 5 to 292 (288 residues), 421.6 bits, E=1.9e-130
• PF00291: PALP
  • amino acids 5 to 281 (277 residues), 251.8 bits, E=4.6e-79

Best Hits

Swiss-Prot: 99% identical to CYSM_ECOLI: Cysteine synthase B (cysM) from Escherichia coli (strain K12)

KEGG orthology group: K12339, cysteine synthase B [EC: 2.5.1.47] (inferred from 99% identity to ebw:BWG_2183)

MetaCyc: 99% identical to cysteine synthase B (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]; Cysteine synthase. [EC: 4.4.1.1, 4.4.1.28, 2.5.1.47]; SULFOCYS-RXN [EC: 4.4.1.1, 4.4.1.28, 2.5.1.47, 2.5.1.144]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (16/18 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-tryptophan degradation II (via pyruvate) (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-cysteine biosynthesis I (2/2 steps found)
• L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-methionine degradation II (2/3 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• seleno-amino acid biosynthesis (plants) (3/5 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• glycine betaine degradation III (4/7 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glycine betaine degradation I (4/8 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• superpathway of L-methionine salvage and degradation (5/16 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.144 or 2.5.1.47 or 4.4.1.1 or 4.4.1.28

Protein Sequence (303 amino acids)

>OHPLBJKB_01302 Cysteine synthase B (Escherichia coli HS(pFamp)R (ATCC 700891))
MSTLEQTIGNTPLVKLQRMGPNNGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKP
GDVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGME
GARDLALEMANRGEGKLLDQFNNPDNPYAHYTTTGPEIWQQTGGRITHFVSSMGTTGTIT
GVSRFMREQSKPVTIVGLQPEEGSSIPGIRRWPAEYLPGIFNASLVDEVLDIHQRDAENT
MRELAVREGIFCGVSSGGAVAGALRVAKANPGAVVVAIICDRGDRYLSTGVFGEEHFSQG
AGI