Protein Info for OHPLBJKB_01243 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Na(+)/H(+) antiporter subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 66 (29 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 127 (18 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 178 to 201 (24 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 335 to 357 (23 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 41 to 74 (34 residues), 32.8 bits, see alignment 5.1e-12 PF00361: Proton_antipo_M" amino acids 104 to 384 (281 residues), 186.7 bits, see alignment E=5.7e-59

Best Hits

Swiss-Prot: 99% identical to HYFD_ECOLI: Hydrogenase-4 component D (hyfD) from Escherichia coli (strain K12)

KEGG orthology group: K12139, hydrogenase-4 component D [EC: 1.-.-.-] (inferred from 99% identity to eco:b2484)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>OHPLBJKB_01243 Na(+)/H(+) antiporter subunit A (Escherichia coli HS(pFamp)R (ATCC 700891))
MGVLFAALTTLCMLSLISTFYQADKVAVTLTLVNVGDVALFGLVIDRVSTLILFVVVFLG
LLVTIYSTGYLTDKNREHPHNGTNRYYAFLLVFIGAMAGLVLSSTLLGQLLFFEITGGCS
WALISYYQSDKAQRSALKALLITHIGSLGLYLAAATLFLQTGTFALSAMSELHGDARYLV
YGGILFAAWGKSAQLPMQAWLPDAMEAPTPISAYLHAASMVKVGVYIFARAIIDGGNIPH
VIGGVGMVMALVTILYGFLMYLPQQDMKRLLAWSTITQLGWMFFGLSLSIFGSRLALEGS
IAYIVNHAFAKSLFFLVAGALSYSCGTRLLPRLRGVLHTLPLPGVGFCVAALAITGVPPF
NGFFSKFPLFAAGFALSVEYWILLPVLRCQWSTGSCCPP