Protein Info for OHPLBJKB_01125 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative tRNA/rRNA methyltransferase YfiF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF08032: SpoU_sub_bind" amino acids 110 to 181 (72 residues), 52.9 bits, see alignment E=3.8e-18 PF00588: SpoU_methylase" amino acids 199 to 336 (138 residues), 109.5 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 100% identical to YFIF_ECO57: Uncharacterized tRNA/rRNA methyltransferase YfiF (yfiF) from Escherichia coli O157:H7

KEGG orthology group: K03214, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to eco:b2581)

Predicted SEED Role

"hypothetical tRNA/rRNA methyltransferase yfiF [EC:2.1.1.-]"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>OHPLBJKB_01125 putative tRNA/rRNA methyltransferase YfiF (Escherichia coli HS(pFamp)R (ATCC 700891))
MNDEMKGKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPGKSRADGGRRPARDDKQSQPR
DRKWEDSPWRTVSRAPGDETPEKADHGGISGKSFIDPEVLRRQRAEETRVYGENACQALF
QSRPEAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELTKASGTEHHGGVCFLIKK
RNGTTVQQWVSQAGAQDCVLALENESNPHNLGGMMRSCAHFGVKGVVVQDAALLESGAAI
RTAEGGAEHVQPITGDNIVNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEY
EGLPDAARDPNDLRVKIDGTGNVAGLNISVATGVLLGEWWRQNKA