Protein Info for OHPLBJKB_01087 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: SsrA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR00086: SsrA-binding protein" amino acids 14 to 156 (143 residues), 181.8 bits, see alignment E=3.7e-58 PF01668: SmpB" amino acids 14 to 157 (144 residues), 194 bits, see alignment E=5.9e-62

Best Hits

Swiss-Prot: 100% identical to SSRP_ESCF3: SsrA-binding protein (smpB) from Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73)

KEGG orthology group: K03664, SsrA-binding protein (inferred from 100% identity to eco:b2620)

Predicted SEED Role

"tmRNA-binding protein SmpB" in subsystem Heat shock dnaK gene cluster extended or Staphylococcal pathogenicity islands SaPI or Trans-translation by stalled ribosomes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>OHPLBJKB_01087 SsrA-binding protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRD
GEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKN
AWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR