Protein Info for OHPLBJKB_01073 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Protein CsiD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF08943: CsiD" amino acids 21 to 314 (294 residues), 497.2 bits, see alignment E=1.5e-153 PF02668: TauD" amino acids 90 to 309 (220 residues), 33.8 bits, see alignment E=3.4e-12

Best Hits

Swiss-Prot: 100% identical to GLAH_ECOLC: Glutarate 2-hydroxylase (glaH) from Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

KEGG orthology group: None (inferred from 98% identity to ecq:ECED1_3112)

MetaCyc: 98% identical to glutarate dioxygenase GlaH (Escherichia coli K-12 substr. MG1655)
RXN0-7316 [EC: 1.14.11.64]

Predicted SEED Role

"Carbon starvation induced protein CsiD"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.11.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>OHPLBJKB_01073 Protein CsiD (Escherichia coli HS(pFamp)R (ATCC 700891))
MNALTAVHNNAVDSGQDYSGFTLIPSAQSPRLLELTFTEQTTKQFLEQVAEWPVQALEYK
SFLRFRVGKILDDLCANQLQPLLLKTLLNRAEGALLINAVGIDDVAQADEMVKLATAVAH
LIGRSNFDAMSGQYYARFVVKNVDNSDSYLRQPHRVMELHNDGTYVEEITDYVLMMKIDE
QNMQGGNSLLLHLDDWEHLDHYFRHPLARRPMRFAAPPSKNVSKDVFHPVFDVDQQGRPV
MRYIDQFVQPKDFEEGVWLSELSDAIETSKGILSVPVPVGKFLLINNLFWLHGRDRFTPH
PDLRRELMRQRGYFAYATHHYQTHQ