Protein Info for OHPLBJKB_01065 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative HTH-type transcriptional regulator YgaV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12840: HTH_20
  • amino acids 21 to 70 (50 residues), 30.8 bits, E=5.8e-11
• PF01022: HTH_5
  • amino acids 23 to 70 (48 residues), 50.4 bits, E=4e-17
• PF13412: HTH_24
  • amino acids 25 to 68 (44 residues), 33.3 bits, E=7e-12
• PF01047: MarR
  • amino acids 26 to 74 (49 residues), 26.4 bits, E=1.3e-09
• PF12802: MarR_2
  • amino acids 27 to 74 (48 residues), 37.4 bits, E=5.8e-13

Best Hits

Swiss-Prot: 100% identical to YGAV_ECOLI: Probable HTH-type transcriptional regulator YgaV (ygaV) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2667)

Predicted SEED Role

"Transcriptional regulator, ArsR family"

Protein Sequence (99 amino acids)

>OHPLBJKB_01065 putative HTH-type transcriptional regulator YgaV (Escherichia coli HS(pFamp)R (ATCC 700891))
MTELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLA
RMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP