Protein Info for OHPLBJKB_01034 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Nicotinamide-nucleotide amidohydrolase PncC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF02464: CinA" amino acids 8 to 159 (152 residues), 200.2 bits, see alignment E=7.7e-64 TIGR00199: amidohydrolase, PncC family" amino acids 13 to 158 (146 residues), 214.1 bits, see alignment E=4.8e-68

Best Hits

Swiss-Prot: 100% identical to PNCC_ECOL6: Nicotinamide-nucleotide amidohydrolase PncC (pncC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03743, (no description) (inferred from 100% identity to eco:b2700)

MetaCyc: 100% identical to NMN aminohydrolase (Escherichia coli K-12 substr. MG1655)
Nicotinamide-nucleotide amidase. [EC: 3.5.1.42]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (165 amino acids)

>OHPLBJKB_01034 Nicotinamide-nucleotide amidohydrolase PncC (Escherichia coli HS(pFamp)R (ATCC 700891))
MTDSELMQLSEQVGQALKARGATVTTAESCTGGWVAKVITDIAGSSAWFERGFVTYSNEA
KAQMIGVREETLAQHGAVSEPVVVEMAIGALKAARADYAVSISGIAGPDGGSEEKPVGTV
WFAFATARGEGITRRECFSGDRDAVRRQATAYALQTLWQQFLQNT