Protein Info for OHPLBJKB_01017 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Hydrogenase 3 maturation protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 TIGR00142: hydrogenase maturation peptidase HycI" amino acids 3 to 147 (145 residues), 229.7 bits, see alignment E=1.1e-72 TIGR00072: hydrogenase maturation protease" amino acids 5 to 140 (136 residues), 119.4 bits, see alignment E=1.3e-38 PF01750: HycI" amino acids 22 to 140 (119 residues), 106.5 bits, see alignment E=4.8e-35

Best Hits

Swiss-Prot: 100% identical to HYCI_ECO57: Hydrogenase 3 maturation protease (hycI) from Escherichia coli O157:H7

KEGG orthology group: K08315, hydrogenase 3 maturation protease [EC: 3.4.-.-] (inferred from 100% identity to eco:b2717)

MetaCyc: 100% identical to hydrogenase 3 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.- or 3.4.23.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>OHPLBJKB_01017 Hydrogenase 3 maturation protease (Escherichia coli HS(pFamp)R (ATCC 700891))
MTDVLLCVGNSMMGDDGAGPLLAEKCAAAPKGNWVVIDGGSAPENDIVAIRELRPTRLLI
VDATDMGLNPGEIRIIDPDDIAEMFMMTTHNMPLNYLIDQLKEDIGEVIFLGIQPDIVGF
YYPMTQPIKDAVETVYQRLEGWEGNGGFAQLAVEEE