Protein Info for OHPLBJKB_01013 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Formate hydrogenlyase subunit 5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 PF00329: Complex1_30kDa" amino acids 35 to 152 (118 residues), 95.2 bits, see alignment E=6.9e-31 PF00374: NiFeSe_Hases" amino acids 218 to 286 (69 residues), 49.4 bits, see alignment E=5.4e-17 PF00346: Complex1_49kDa" amino acids 296 to 465 (170 residues), 120.2 bits, see alignment E=1.3e-38 amino acids 465 to 537 (73 residues), 42 bits, see alignment E=9.3e-15

Best Hits

Swiss-Prot: 100% identical to HYCE_ECOLI: Formate hydrogenlyase subunit 5 (hycE) from Escherichia coli (strain K12)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to eco:b2721)

MetaCyc: 100% identical to hydrogenase 3 large subunit (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (569 amino acids)

>OHPLBJKB_01013 Formate hydrogenlyase subunit 5 (Escherichia coli HS(pFamp)R (ATCC 700891))
MSEEKLGQHYLAALNEAFPGVVLDHAWQTKDQLTVTVKVNYLPEVVEFLYYKQGGWLSVL
FGNDERKLNGHYAVYYVLSMEKGTKCWITVRVEVDANKPEYPSVTPRVPAAVWGEREVRD
MYGLIPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPAPTTDAETYEFINELGDKKNN
VVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEKLAETRMGYNEVTFLSDRV
CGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERLHSHLLNLGLACHFTGFDSG
FMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKDDMIQTRQLAQQMRREVQELV
DVLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGHARDTRADHPFVGYGLLPMEVH
SEQGCDVISRLKVRINEVYTALNMIDYGLDNLPGGPLMVEGFTYIPHRFALGFAEAPRGD
DIHWSMTGDNQKLYRWRCRAATYANWPTLRYMLRGNTVSDAPLIIGSLDPCYSCTDRMTV
VDVRKKKSKVVPYKELERYSIERKNSPLK