Protein Info for OHPLBJKB_00983 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Adenylyl-sulfate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 transmembrane" amino acids 92 to 109 (18 residues), see Phobius details TIGR00455: adenylyl-sulfate kinase" amino acids 10 to 193 (184 residues), 296.6 bits, see alignment E=3.1e-93 PF01583: APS_kinase" amino acids 27 to 179 (153 residues), 243.2 bits, see alignment E=1.2e-76 PF13671: AAA_33" amino acids 30 to 143 (114 residues), 32.5 bits, see alignment E=9.9e-12

Best Hits

Swiss-Prot: 100% identical to CYSC_SHISS: Adenylyl-sulfate kinase (cysC) from Shigella sonnei (strain Ss046)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to eco:b2750)

MetaCyc: 100% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (201 amino acids)

>OHPLBJKB_00983 Adenylyl-sulfate kinase (Escherichia coli HS(pFamp)R (ATCC 700891))
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTY
LLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRE
RVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQ
LVTNLVQQLLDLLRQNDIIRS