Protein Info for OHPLBJKB_00976 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: CRISPR system Cascade subunit CasD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR01868: CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI" amino acids 3 to 216 (214 residues), 281.6 bits, see alignment E=5.4e-88 PF09704: Cas_Cas5d" amino acids 4 to 179 (176 residues), 136.6 bits, see alignment E=6e-44 TIGR02593: CRISPR-associated protein Cas5" amino acids 4 to 46 (43 residues), 53.5 bits, see alignment 1.6e-18

Best Hits

Swiss-Prot: 97% identical to CAS5_ECOLI: CRISPR system Cascade subunit CasD (casD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecx:EcHS_A2896)

MetaCyc: 97% identical to type I-E CRISPR system Cascade subunit CasD (Escherichia coli K-12 substr. MG1655)
RXN0-5435

Predicted SEED Role

"CRISPR-associated protein, Cas5e family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>OHPLBJKB_00976 CRISPR system Cascade subunit CasD (Escherichia coli HS(pFamp)R (ATCC 700891))
MKSYLILRLAGPMQAWGQPTFEGTRPTGRFPTRSGLLGLLGACLGIQRDDTSSLQALSES
VQFAVRCDELILDDRRVSVTGLRDYHTVLGAREDYRGLKSHETIQTWREYLCDASFTIAI
WLTPQATMVMSELEKAVLKPRYTPYLGRRSCPLTHPLFLATCQASDPQKALLNYEPVGGD
IYSEESVTGHHLKFTARDEPMITLPRQFASREWYVIKGGMDVSQ