Protein Info for OHPLBJKB_00973 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: CRISPR system Cascade subunit CasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 45 to 61 (17 residues), see Phobius details PF09481: CRISPR_Cse1" amino acids 2 to 459 (458 residues), 290.1 bits, see alignment E=2.1e-90 TIGR02547: CRISPR type I-E/ECOLI-associated protein CasA/Cse1" amino acids 2 to 496 (495 residues), 532.1 bits, see alignment E=8.5e-164

Best Hits

Swiss-Prot: 97% identical to CSE1_ECOLI: CRISPR system Cascade subunit CasA (casA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecx:EcHS_A2899)

MetaCyc: 97% identical to type I-E CRISPR system Cascade subunit CasA (Escherichia coli K-12 substr. MG1655)
RXN0-5435

Predicted SEED Role

"CRISPR-associated protein, Cse1 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (502 amino acids)

>OHPLBJKB_00973 CRISPR system Cascade subunit CasA (Escherichia coli HS(pFamp)R (ATCC 700891))
MNLLIDNWIPVRPQSGGKVQIINLQSLFCSKNQWRLSLPRDDMELAALALLVCIGQIIAP
AKDDVEFRHRIMNPLSEDEFQRLIAPWIDMFYLNHAEHPFMQTKGVKANDVTPMEKLLAG
VSGATNCAFVNQPGQGEALCGGCTAIALFNQANQAPGFGGGFKSGLRGGTPITTFVRGID
LRSTVLLNVLTIPRLQKQFPNESHTENQPTWIKPVKPNESVPASSIGFVRGLFWQPAHIE
LCDPIGIGKCSCCGQESNLRYTGFLKEKFTFTVNGLWPHPHSPCLVTVKKGEVEEKFLAF
TTSAPSWTQISRVVVDKIIQNENGNRVAAVVNQFRNIASQSPLELIMGGYRNNQASILER
RHDVLMFNQGWQQYGNVINEIVTVGLGYKTALRKALYTFAEGFKNKDFKGAGVSVHETAE
RHFYRQSELLILDVLANINFSQADEVIADLRDKLHQLCEMLFNQSVAPYAHHPKLISTLA
LARATLYKHLRELKPQGGPSNG