Protein Info for OHPLBJKB_00897 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 85 to 101 (17 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details PF03741: TerC" amino acids 17 to 203 (187 residues), 168 bits, see alignment E=9.6e-54

Best Hits

Swiss-Prot: 100% identical to YGDQ_ECOL6: UPF0053 inner membrane protein YgdQ (ygdQ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eco:b2832)

Predicted SEED Role

"FIG003462: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>OHPLBJKB_00897 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MLFAWITDPNAWLALGTLTLLEIVLGIDNIIFLSLVVAKLPTAQRAHARRLGLAGAMVMR
LALLASIAWVTRLTNPLFTIFSQEISARDLILLLGGLFLIWKASKEIHESIEGEEEGLKT
RVSSFLGAIVQIMLLDIIFSLDSVITAVGLSDHLFIMMAAVVIAVGVMMFAARSIGDFVE
RHPSVKMLALSFLILVGFTLILESFDIHVPKGYIYFAMFFSIAVESLNLIRNKKNPL