Protein Info for OHPLBJKB_00884 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Inner membrane transport protein YqeG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 334 to 355 (22 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 390 to 408 (19 residues), see Phobius details PF03222: Trp_Tyr_perm" amino acids 16 to 378 (363 residues), 43.1 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 100% identical to YQEG_ECOLI: Inner membrane transport protein YqeG (yqeG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2845)

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>OHPLBJKB_00884 Inner membrane transport protein YqeG (Escherichia coli HS(pFamp)R (ATCC 700891))
MSNIWSKEETLWSFALYGTAVGAGTLFLPIQLGSAGAVVLFITALVAWPLTYWPHKALCQ
FILSSKTSAGEGITGAVTHYYGKKIGNLITTLYFIAFFVVVLIYAVAITNSLTEQLAKHM
VIDLRIRMLVSLGVVLILNLIFLMGRHATIRVMGFLVFPLIAYFLFLSIYLVGSWQPDLL
TTQVEFNQNTLHQIWISIPVMVFAFSHTPIISTFAIDRREKYGEHAMDKCKKIMKVAYLI
ICISVLFFVFSCLLSIPPSYIEAAKEEGVTILSALSMLPNAPAWLSISGIIVAVVAMSKS
FLGTYFGVIEGATEVVKTTLQQVGVKKSRAFNRALSIMLVSLITFIVCCINPNAISMIYA
ISGPLIAMILFIMPTLSTYLIPALKPWRSIGNLITLIVGILCVSVMFFS