Protein Info for OHPLBJKB_00855 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Surface presentation of antigens protein SpaO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR02551: type III secretion apparatus protein, YscQ/HrcQ family" amino acids 31 to 307 (277 residues), 193 bits, see alignment E=5.8e-61 PF01052: FliMN_C" amino acids 239 to 308 (70 residues), 44.3 bits, see alignment E=6.9e-16

Best Hits

KEGG orthology group: K03225, type III secretion protein SctQ (inferred from 100% identity to ecl:EcolC_0845)

Predicted SEED Role

"Type III secretion inner membrane protein (YscQ,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>OHPLBJKB_00855 Surface presentation of antigens protein SpaO (Escherichia coli HS(pFamp)R (ATCC 700891))
MFGLRKVNRNTHTFETTFQNWKENGEDVALLMPEFSAKWLPIAEESGSWSGWVLLGEIFP
LISSELAGMALMPETERLIGEWLSLSSSPLNLKHPELKYNRLRVGKVFDGVLSSAQPLIR
IWTGELNLWLDKVTVCQYGNAPALDKKSLYCSIHFVIGFSKTCYRSLVDIEVGDVLLISN
NLAYAVIYNTKIFDLIYPEELKMADHFEYEEDFETDDFDIKKNESEIYDENDDQMINSFE
DLPVKIEFVLGKKIMNLYEIDELCAKRIISLLSESEKNIEIRVNGALTGYGELVEVDDKL
GVEIHSWLSGHNNVK