Protein Info for OHPLBJKB_00811 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 TIGR00527: glycine cleavage system H protein" amino acids 3 to 129 (127 residues), 203.5 bits, see alignment E=5.2e-65 PF01597: GCV_H" amino acids 8 to 128 (121 residues), 170.5 bits, see alignment E=6.7e-55

Best Hits

Swiss-Prot: 100% identical to GCSH_SALPK: Glycine cleavage system H protein (gcvH) from Salmonella paratyphi A (strain AKU_12601)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to eco:b2904)

MetaCyc: 100% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>OHPLBJKB_00811 Glycine cleavage system H protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAV
AESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDAT
AYEALLEDE