Protein Info for OHPLBJKB_00758 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF11101: DUF2884" amino acids 24 to 234 (211 residues), 74.7 bits, see alignment E=4.5e-25

Best Hits

Swiss-Prot: 100% identical to YGGN_ECOL6: Uncharacterized protein YggN (yggN) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eco:b2958)

Predicted SEED Role

"FIG004016: Uncharacterized protein YggN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>OHPLBJKB_00758 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MMRKMLLAAALSVTAMTAHADYQCSVTPRDDVIVSPQTVQVKGENGNLVITPDGNVMYNG
KQYSLNAAQREQAKDYQAELRSTLPWIDEGAKSRVEKARIALDKIIVQEMGESSKMRSRL
TKLDAQLKEQMNRIIETRSDGLTFHYKAIDQVRAEGQQLVNQAMGGILQDSINEMGAKAV
LKSGGNPLQNVLGSLGGLQSSIQTEWKKQEKDFQQFGKDVCSRVVTLEDSRKALVGNLK