Protein Info for OHPLBJKB_00636 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: DNA primase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 TIGR01391: DNA primase" amino acids 4 to 419 (416 residues), 502.8 bits, see alignment E=3.5e-155 PF01807: zf-CHC2" amino acids 7 to 100 (94 residues), 139.6 bits, see alignment E=9.8e-45 PF08275: DNAG_N" amino acids 126 to 251 (126 residues), 151.3 bits, see alignment E=6e-48 PF13662: Toprim_4" amino acids 260 to 325 (66 residues), 57.7 bits, see alignment E=4.7e-19 PF13362: Toprim_3" amino acids 261 to 356 (96 residues), 29.4 bits, see alignment E=3.6e-10 PF01751: Toprim" amino acids 261 to 337 (77 residues), 56.6 bits, see alignment E=9.8e-19 PF13155: Toprim_2" amino acids 263 to 348 (86 residues), 65.3 bits, see alignment E=2.2e-21 PF10410: DnaB_bind" amino acids 369 to 424 (56 residues), 54.5 bits, see alignment 4.3e-18 PF08278: DnaG_DnaB_bind" amino acids 451 to 574 (124 residues), 113.6 bits, see alignment E=3.4e-36

Best Hits

Swiss-Prot: 100% identical to DNAG_SHIFL: DNA primase (dnaG) from Shigella flexneri

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to eco:b3066)

MetaCyc: 100% identical to DNA primase (Escherichia coli K-12 substr. MG1655)
RXN0-5021 [EC: 2.7.7.101, 2.7.7.102]

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.101 or 2.7.7.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>OHPLBJKB_00636 DNA primase (Escherichia coli HS(pFamp)R (ATCC 700891))
MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNFHACCPFHNEKTPSFTVNGEKQFYH
CFGCGAHGNAIDFLMNYDKLEFVETVEELAAMHNLEVPFEAGSGPSQIERHQRQTLYQLM
DGLNTFYQQSLQQPVATSARQYLEKRGLSHEVIARFAIGFAPPGWDNVLKRFGGNPENRQ
SLIDAGMLVTNDQGRSYDRFRERVMFPIRDKRGRVIGFGGRVLGNDTPKYLNSPETDIFH
KGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRA
TNNVICCYDGDRAGRDAAWRALETALPYMTDGRQLRFMFLPDDEDPDTLVRKEGKEAFEA
RMEQAMPLSAFLFNSLMPQVDLSTPDGRARLSTLALPLISQVPGETLRIYLRQELGNKLG
ILDDSQLERLMPKAAESGVSRPVPQLKRTTMRILIGLLVQNPELATLVPPLENLDENKLP
GLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATLEKLSMWDDIADKNIAEQTFTDSLN
HMFDSLLELRQEELIARERTHGLSNEERLELWTLNQELAKK