Protein Info for OHPLBJKB_00628 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: tRNA-binding protein YgjH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF01588: tRNA_bind" amino acids 14 to 107 (94 residues), 115 bits, see alignment E=7e-38

Best Hits

Swiss-Prot: 99% identical to YGJH_ECOLI: tRNA-binding protein YgjH (ygjH) from Escherichia coli (strain K12)

KEGG orthology group: K06878, tRNA-binding protein (inferred from 99% identity to eco:b3074)

Predicted SEED Role

"tRNA-binding protein YgjH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>OHPLBJKB_00628 tRNA-binding protein YgjH (Escherichia coli HS(pFamp)R (ATCC 700891))
METVAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGEKTLQTVTSLVPYYSEEELMG
KTVVVLCNLQKAKMRGETSECMLLCAETDDGSESVLLTPERMMPAGVRVV