Protein Info for OHPLBJKB_00627 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: HTH-type transcriptional regulator LacR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00356: LacI" amino acids 3 to 49 (47 residues), 62.4 bits, see alignment 4e-21 PF00532: Peripla_BP_1" amino acids 63 to 307 (245 residues), 29 bits, see alignment E=1.1e-10 PF13377: Peripla_BP_3" amino acids 167 to 326 (160 residues), 106.4 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 99% identical to EBGR_ECOLI: HTH-type transcriptional regulator EbgR (ebgR) from Escherichia coli (strain K12)

KEGG orthology group: K12113, LacI family transcriptional regulator, ebg operon repressor (inferred from 99% identity to eco:b3075)

Predicted SEED Role

"Evolved beta-D-galactosidase transcriptional repressor" in subsystem Lactose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>OHPLBJKB_00627 HTH-type transcriptional regulator LacR (Escherichia coli HS(pFamp)R (ATCC 700891))
MATLKDIAIEAGVSLATVSRVLNDDPTLNVKEETKHRILEIAEKLEYKTSSARKLQTGAV
NQHHILAIYSYQQELEINDPYYLAIRHGIETQCEKLGIELTNCYEHSGLPDIKNVTGILI
VGKPTPALRAAASALTDNICFIDFHEPGSGYDAVDIDLARISKEIIDFYINQGVNRIGFI
GGEDEPGKADIREVAFVEYGRLKQVVREEDIWRGGFSSSSGYELAKQMLSREDYPKALFV
ASDSIAIGVLRAIHERGLNIPQDISLISVNDIPTARFTFPPLSTVRIHSEMMGSQGVNLV
YEKARDGRALPLLVFVPSKLKLRGTTR