Protein Info for OHPLBJKB_00611 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Altronate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 PF08666: SAF" amino acids 10 to 81 (72 residues), 46.5 bits, see alignment E=6.7e-16 PF04295: GD_AH_second" amino acids 111 to 244 (134 residues), 161.3 bits, see alignment E=2.2e-51 PF20629: GD_AH_C" amino acids 255 to 493 (239 residues), 332.3 bits, see alignment E=2.5e-103

Best Hits

Swiss-Prot: 99% identical to UXAA_ECOLI: Altronate dehydratase (uxaA) from Escherichia coli (strain K12)

KEGG orthology group: K01685, altronate hydrolase [EC: 4.2.1.7] (inferred from 99% identity to eco:b3091)

MetaCyc: 99% identical to D-altronate dehydratase (Escherichia coli K-12 substr. MG1655)
Altronate dehydratase. [EC: 4.2.1.7]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (495 amino acids)

>OHPLBJKB_00611 Altronate dehydratase (Escherichia coli HS(pFamp)R (ATCC 700891))
MQYIKIHALDNVAVALADLAEGTEVSVDNQTVRLRQDVARGHKFALTNIAKGANVIKYGL
PIGYALADIAAGEHVHAHNTRTNLSDLDQYRYQPDFQDLPAQAADREVQIYRRANGDVGV
RNELWILPTVGCVNGIARQIQNRFLKETNNAEGTDGVFLFSHTYGCSQLGDDHINTRTML
QNMVRHPNAGAVLVIGLGCENNQVAAFRETLGDIDPERVHFMICQQQDDEIEAGIEHLHQ
LYNVMRNDKREPGKLSELKFGLECGGSDGLSGITANPMLGRFSDYVIANGGTTVLTEVPE
MFGAEQLLMDHCRDEATFEKLVTMVNDFKQYFIAHDQPIYENPSPGNKAGGITTLEDKSL
GCTQKAGSSVVVDVLRYGERLKTPGLNLLSAPGNDAVATSALAGAGCHMVLFSTGRGTPY
GGFVPTVKIATNSELAAKKKHWIDFDAGQLIHGKAMPQLLEEFIDTIVEFANGKQTCNER
NDFRELAIFKSGVTL