Protein Info for OHPLBJKB_00589 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative serine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 318 to 339 (22 residues), see Phobius details amino acids 363 to 381 (19 residues), see Phobius details amino acids 388 to 411 (24 residues), see Phobius details amino acids 423 to 442 (20 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to DLST_ECOLI: Probable serine transporter (dlsT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3110)

MetaCyc: 100% identical to L-cysteine importer (Escherichia coli K-12 substr. MG1655)
RXN-23966

Predicted SEED Role

"Serine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions or Threonine anaerobic catabolism gene cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>OHPLBJKB_00589 putative serine transporter (Escherichia coli HS(pFamp)R (ATCC 700891))
MEIASNKGVIADASTPAGRAGMSESEWREAIKFDSTDTGWVIMSIGMAIGAGIVFLPVQV
GLMGLWVFLLSSVIGYPAMYLFQRLFINTLAESPECKDYPSVISGYLGKNWGILLGALYF
VMLVIWMFVYSTAITNDSASYLHTFGVTEGLLSDSPFYGLVLICILVAISSRGEKLLFKI
STGMVLTKLLVVAALGVSMVGMWHLYNVGSLPPLGLLVKNAIITLPFTLTSILFIQTLSP
MVISYRSREKSIEVARHKALRAMNIAFGILFVTVFFYAVSFTLAMGHDEAVKAYEQNISA
LAIAAQFISGDGAAWVKVVSVILNNFAVMTAFFGVYLGFREATQGIVMNILRRKMPAEKI
NENLVQRGIMIFAILLAWSAIVLNAPVLSFTSICSPIFGMVGCLIPAWLVYKVPALHKYK
GMSLYLIIVTGLLLCVSPFLAFS