Protein Info for OHPLBJKB_00537 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Lipoprotein NlpI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13181: TPR_8" amino acids 62 to 94 (33 residues), 15.4 bits, see alignment 6e-06 PF13432: TPR_16" amino acids 67 to 128 (62 residues), 28.1 bits, see alignment E=8.3e-10 amino acids 103 to 164 (62 residues), 20.7 bits, see alignment E=1.7e-07 PF07719: TPR_2" amino acids 96 to 129 (34 residues), 23.1 bits, see alignment 1.9e-08

Best Hits

Swiss-Prot: 100% identical to NLPI_ECOL5: Lipoprotein NlpI (nlpI) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K05803, lipoprotein NlpI (inferred from 100% identity to eco:b3163)

Predicted SEED Role

"Lipoprotein nlpI precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>OHPLBJKB_00537 Lipoprotein NlpI (Escherichia coli HS(pFamp)R (ATCC 700891))
MKPFLRWCFVATALTLAGCSNTSWRKSEVLAVPLQPTLQQEVILARMEQILASRALTDDE
RAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFD
SVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEK
QAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDNTSLAEHLSETNFYL
GKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQDQDDLAESDQQ