Protein Info for OHPLBJKB_00510 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Acid stress protein IbaG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 PF01722: BolA" amino acids 22 to 79 (58 residues), 51.5 bits, see alignment E=4.9e-18

Best Hits

Swiss-Prot: 100% identical to IBAG_SHIFL: Acid stress protein IbaG (ibaG) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_4512)

Predicted SEED Role

"YrbA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (89 amino acids)

>OHPLBJKB_00510 Acid stress protein IbaG (Escherichia coli HS(pFamp)R (ATCC 700891))
MIEDPMENNEIQSVLMNALSLQEVHVSGDGSHFQVIAVGELFDGMSRVKKQQTVYGPLME
YIADNRIHAVSIKAYTPAEWARDRKLNGF