Protein Info for OHPLBJKB_00477 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Putative cryptic C4-dicarboxylate transporter DcuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 12 (12 residues), see Phobius details amino acids 27 to 30 (4 residues), see Phobius details transmembrane" amino acids 13 to 26 (14 residues), see Phobius details amino acids 31 to 37 (7 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details PF03606: DcuC" amino acids 1 to 328 (328 residues), 344.5 bits, see alignment E=8.4e-107 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 1 to 318 (318 residues), 535.7 bits, see alignment E=4.2e-165 PF06808: DctM" amino acids 53 to 326 (274 residues), 24.5 bits, see alignment E=1.2e-09

Best Hits

Predicted SEED Role

"Putative cryptic C4-dicarboxylate transporter DcuD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>OHPLBJKB_00477 Putative cryptic C4-dicarboxylate transporter DcuD (Escherichia coli HS(pFamp)R (ATCC 700891))
MAQFITSASGLGMLLMVTLFPTLVSLGVSRLSAVAVIATTMSIEWGILETNSIFAAQVAG
MKIATYFFHYQLPVASCVIISVAISHFFVQRAFDKKDKNINHEQAEQKALDNVPPLYYAI
LPVMPLILMLGSLFLAHVGLMQSELHLVVVMLLSLTVTMFVEFFRKHNLRETMDDVQAFF
DGMGTQFANVVTLVVAGEIFAKGLTTIGTVDAVIRGAEHSGLGGIGVMIIMALVIAICAI
VMGSGNAPFMSFASLIPNIAAGLHVPAVVMIMPMHFATTLARAVSPITAVVVVTSGIAGV
SPFAVVKRTAIPMAVGFVVNMIATITLFY