Protein Info for OHPLBJKB_00371 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Putative type II secretion system protein K

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21687: T2SSK_1st
  • amino acids 103 to 211 (109 residues), 108.4 bits, E=3.1e-35
• PF03934: T2SSK
  • amino acids 216 to 274 (59 residues), 47.4 bits, E=2.1e-16

Best Hits

Swiss-Prot: 100% identical to GSPK_ECOLI: Putative type II secretion system protein K (gspK) from Escherichia coli (strain K12)

KEGG orthology group: K02460, general secretion pathway protein K (inferred from 100% identity to eco:b3332)

MetaCyc: 100% identical to type II secretion system protein GspK (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"General secretion pathway protein K"

Protein Sequence (327 amino acids)

>OHPLBJKB_00371 Putative type II secretion system protein K (Escherichia coli HS(pFamp)R (ATCC 700891))
MNNEQRGVALLIVLMLLALMAALAADMTLSFHSQLQRTRQVNHHLQRQYDIELAEKLALA
SLTQDVKDNDRQTTLQQYWAQPQQLQLEDGNTVKWQLRDAQHCFNLNALAKISDDPLASP
DFPAQVFSALLINAGIDRGNTDEIVQSIADYIDVDDSPRFHGAEDSFYQSQTPPRHSANQ
MLFLTGELRQIKGITENIYQRLIPYVCVLPTTELSINLNMLTENDIPLFRALFLNNITDA
DARVLLQKRPREGWLTTDAFLYWAQQDFSGVKPLVAQVKRHLFPYSRYFTLSTESISDEQ
SQGWQSHIFFNRKQQSAQIYRRTLQLY