Protein Info for OHPLBJKB_00367 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Bacterioferritin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00754: bacterioferritin" amino acids 1 to 157 (157 residues), 279.6 bits, see alignment E=3.6e-88 PF00210: Ferritin" amino acids 8 to 144 (137 residues), 133.8 bits, see alignment E=2.1e-43

Best Hits

Swiss-Prot: 100% identical to BFR_ECOL6: Bacterioferritin (bfr) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03594, bacterioferritin (inferred from 100% identity to eco:b3336)

MetaCyc: 100% identical to bacterioferritin (Escherichia coli K-12 substr. MG1655)
Ferroxidase. [EC: 1.16.3.1]

Predicted SEED Role

"Bacterioferritin" in subsystem Iron acquisition in Vibrio

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>OHPLBJKB_00367 Bacterioferritin (Escherichia coli HS(pFamp)R (ATCC 700891))
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIE
RILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMM
IEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREEG