Protein Info for OHPLBJKB_00362 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: 30S ribosomal protein S7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00177: Ribosomal_S7
  • amino acids 1 to 149 (149 residues), 215.4 bits, E=1.4e-68
• TIGR01029: ribosomal protein uS7
  • amino acids 3 to 156 (154 residues), 236.5 bits, E=5.8e-75

Best Hits

Swiss-Prot: 100% identical to RS7_SHIBS: 30S ribosomal protein S7 (rpsG) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02992, small subunit ribosomal protein S7 (inferred from 100% identity to eco:b3341)

MetaCyc: 100% identical to 30S ribosomal subunit protein S7 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S7p (S5e)" in subsystem Ribosome SSU bacterial

Protein Sequence (156 amino acids)

>OHPLBJKB_00362 30S ribosomal protein S7 (Escherichia coli HS(pFamp)R (ATCC 700891))
MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELE
AFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRL
ANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRW