Protein Info for OHPLBJKB_00351 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: General stress protein 14

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to KEFG_ECO5E: Glutathione-regulated potassium-efflux system ancillary protein KefG (kefG) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K11748, glutathione-regulated potassium-efflux system ancillary protein KefG (inferred from 100% identity to eco:b3351)

MetaCyc: 43% identical to regulator of KefC-mediated potassium transport and quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ancillary protein KefG" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

MetaCyc Pathways

superpathway of photosynthetic hydrogen production (3/6 steps found)
vitamin K-epoxide cycle (1/4 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>OHPLBJKB_00351 General stress protein 14 (Escherichia coli HS(pFamp)R (ATCC 700891))
MSQPAKVLLLYAHPESQDSVANRVLLKPATQLSNVTVHDLYAHYPDFFIDIPREQALLRE
HEVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLAGKYWRSVITTGEPESAYRY
DALNRYPMSDVLRPFELAAGMCRMHWLSPIIIYWARRQSAQELASHARAYGDWLANPLSP
GGR