Protein Info for OHPLBJKB_00324 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Phosphotriesterase homology protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF02126: PTE" amino acids 1 to 292 (292 residues), 485.3 bits, see alignment E=3.9e-150

Best Hits

Swiss-Prot: 99% identical to PHP_ECOLI: Phosphotriesterase homology protein (php) from Escherichia coli (strain K12)

KEGG orthology group: K07048, phosphotriesterase-related protein (inferred from 99% identity to eco:b3379)

Predicted SEED Role

"Phosphotriesterase like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>OHPLBJKB_00324 Phosphotriesterase homology protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MSFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMG
RNAQFMLDVMRETGINVVACTGYYQDAYFPEHVATRSVQELAQEMVDEIEQGIDGTELKA
GIIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLS
RVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVML
SMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRETPSQFFQ