Protein Info for OHPLBJKB_00302 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: 33 kDa chaperonin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF01430: HSP33" amino acids 5 to 273 (269 residues), 285.9 bits, see alignment E=1.7e-89

Best Hits

Swiss-Prot: 100% identical to HSLO_ECO27: 33 kDa chaperonin (hslO) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K04083, molecular chaperone Hsp33 (inferred from 100% identity to eco:b3401)

Predicted SEED Role

"33 kDa chaperonin (Heat shock protein 33) (HSP33)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>OHPLBJKB_00302 33 kDa chaperonin (Escherichia coli HS(pFamp)R (ATCC 700891))
MPQHDQLHRYLFENFAVRGELVTVSETLQQILENHDYPQPVKNVLAELLVATSLLTATLK
FDGDITVQLQGDGPMNLAVINGNNNQQMRGVARVQGEIPENADLKTLVGNGYVVITITPS
EGERYQGVVGLEGDTLAACLEDYFMRSEQLPTRLFIRTGDVDGKPAAGGMLLQVMPAQNA
QQDDFDHLATLTETIKTEELLTLPANEVLWRLYHEEEVTVYDPQDVEFKCTCSRERCADA
LKTLPDEEVDSILAEDGEIDMHCDYCGNHYLFNAMDIAEIRNNASPADPQVH