Protein Info for OHPLBJKB_00301 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 66 to 85 (20 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 320 to 340 (21 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details PF13687: DUF4153" amino acids 52 to 414 (363 residues), 99.6 bits, see alignment E=1.2e-32

Best Hits

Swiss-Prot: 100% identical to YHGE_ECOLI: Uncharacterized protein YhgE (yhgE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3402)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (574 amino acids)

>OHPLBJKB_00301 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MDNVELSPATRWGMIATGLLQGLVCYLLIAWLSGKNHSWIVYGVPATVAFSSVLLFSVIS
FKQKRLWGWLALVFIATLGMSGWLKWQTDGMNPWRAEKALWDFGCYLLLMAMLLLPWIQQ
SLRIRNDSSRYRYFYQSVWHNVLILLVIFLANGLTWLVLLLWSELFKLVGITFFNTLFFA
TDWFIYLTLGLVTALAVILARTQSRLIDSIQKLFTLIATGLLPLVSLLTLMFIITLPFTG
LSAISRHISAAGLLLTLAFLQLILMAIVRDPQKASLPWTGPLRCLIKTALLVAPLYVFVA
AWALWLRVAQYGWTVDRLQGVLAVLVLLVWSLGYFVSIVWRKGQNPVVLQGKVNLAVSLL
VLVILVLLNSPVLDSMRISVNSHMARYQSGKNTSDQVTIYMLEQSGRYGRAALESLKSDA
GFMKDPKRARDLLMALDGEQHLQQQVSEKVLADNVLIAPGSVKPDATFWSALIQDRYNVM
TCIEKDACVLVEQDLNSDGQAERILFAFNDDRVIVYGFDSDRKEWDALDMSLLPNEITKE
KLLTAAKDGKLGTKPKAWRDLVVDGERLNVNLNE