Protein Info for OHPLBJKB_00252 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Lactose transport system permease protein LacG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 7 to 33 (27 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 92 to 276 (185 residues), 82.6 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 100% identical to UGPE_SHIFL: sn-glycerol-3-phosphate transport system permease protein UgpE (ugpE) from Shigella flexneri

KEGG orthology group: K05815, sn-glycerol 3-phosphate transport system permease protein (inferred from 99% identity to ebd:ECBD_0290)

MetaCyc: 99% identical to sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>OHPLBJKB_00252 Lactose transport system permease protein LacG (Escherichia coli HS(pFamp)R (ATCC 700891))
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHN
IWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT
LMLPVEVRIFPTVEVIANLKMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID
GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT
GEGTTEWNSVMAAMLLTLIPPVVIVLVMQRAFVRGLVDSEK