Protein Info for OHPLBJKB_00189 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Multidrug resistance protein MdtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00529: CusB_dom_1" amino acids 34 to 357 (324 residues), 51.4 bits, see alignment E=1.7e-17 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 36 to 369 (334 residues), 267.5 bits, see alignment E=7.1e-84 PF16576: HlyD_D23" amino acids 60 to 289 (230 residues), 60.8 bits, see alignment E=2.4e-20 PF13533: Biotin_lipoyl_2" amino acids 60 to 109 (50 residues), 31.6 bits, see alignment 2.2e-11 PF13437: HlyD_3" amino acids 172 to 286 (115 residues), 23.7 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 100% identical to MDTE_ECOLI: Multidrug resistance protein MdtE (mdtE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3513)

MetaCyc: 100% identical to multidrug efflux pump membrane fusion protein MdtE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-359; TRANS-RXN-367

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>OHPLBJKB_00189 Multidrug resistance protein MdtE (Escherichia coli HS(pFamp)R (ATCC 700891))
MNRRRKLLIPLLFCGAMLTACDDKSAENAAAMTPEVGVVTLSPGSVNVLSELPGRTVPYE
VAEIRPQVGGIIIKRNFIEGDKVNQGDSLYQIDPAPLQAELNSAKGSLAKALSTASNARI
TFNRQASLLKTNYVSRQDYDTARTQLNEAEANVTVAKAAVEQATINLQYANVTSPITGVS
GKSSVTVGALVTANQADSLVTVQRLDPIYVDLTQSVQDFLRMKEEVASGQIKQVQGSTPV
QLNLENGKRYSQTGTLKFSDPTVDETTGSVTLRAIFPNPNGDLLPGMYVTALVDEGSRQN
VLLVPQEGVTHNAQGKATALILDKDDVVQLREIEASKAIGDQWVVTSGLQAGDRVIVSGL
QRIRPGIKARAISSSQENASTESKQ