Protein Info for OHPLBJKB_00143 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: O-acetyltransferase WecH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 318 (314 residues), 159.3 bits, see alignment E=6.4e-51

Best Hits

Swiss-Prot: 98% identical to WECH_ECOLI: O-acetyltransferase WecH (wecH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b3561)

Predicted SEED Role

"Inner membrane protein YiaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>OHPLBJKB_00143 O-acetyltransferase WecH (Escherichia coli HS(pFamp)R (ATCC 700891))
MQPKIYWIDNLRGIACLMVVMIHTTTWYVTNAHSVSPVTWDIANVLNSASRVSVPLFFMI
SGYLFFGERSAQPRHFLRIGLCLFFYSAIALLYIALFTSINVELALKNLLQKPVFYHLWF
FFAIAVIYLVSPLIQVKNVGGKMLLVLMVVIGIIANPNTVPQKIDGFEWLPMNLYINGDT
FYYILYGMLGRAIGMMDTQHKALSWVSAVLFVTGVFIISRGTLYELQWRGNFADTWYLYC
GPMVFICAIALLTLIKNTLDTRTIRGLGLISRHSLGIYGFHALIIHALRTRGIELKNWPI
LDIIWIFCATLAASLLLSMLVQRIDRNRLVS