Protein Info for OHPLBJKB_00076 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: General stress protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF01501: Glyco_transf_8" amino acids 25 to 276 (252 residues), 242.5 bits, see alignment E=8.6e-76 PF08437: Glyco_transf_8C" amino acids 278 to 334 (57 residues), 65.5 bits, see alignment E=5.3e-22

Best Hits

Swiss-Prot: 41% identical to RFAJ_ECOLI: Lipopolysaccharide 1,2-glucosyltransferase (rfaJ) from Escherichia coli (strain K12)

KEGG orthology group: K12985, (galactosyl)LPS 1,2-glucosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to ecl:EcolC_0085)

MetaCyc: 41% identical to UDP-glucose:(glucosyl)LPS alpha-1,2-glucosyltransferase (Escherichia coli K-12 substr. MG1655)
Lipopolysaccharide glucosyltransferase I. [EC: 2.4.1.58]

Predicted SEED Role

"UDP-galactose:(galactosyl) LPS alpha1,2-galactosyltransferase WaaW (EC 2.4.1.-)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-, 2.4.1.58

Use Curated BLAST to search for 2.4.1.- or 2.4.1.58

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>OHPLBJKB_00076 General stress protein A (Escherichia coli HS(pFamp)R (ATCC 700891))
MDLLAESITEVAVSGEIANTDRVLNIAYGIDRNFLFGAAVSMQSVVMHNPDLAVKFHLFT
DYIDEDYLQRVNAFTSKNANVEVRIYKVSNAFIDIFPSLKQWSYATFFRLVAFQYLSETI
ENLLYIDADVICKGSLAGLLDINFDGDKFAAVIKDVPFMQEKPAKRLAIEGLPGNYFNAG
VVYLQLEAWAKNDFMNKAIAMLASDPQHTKYKCLDQDILNILFFGHCIFISGDYDCFYGI
DYELKNKSDEDYKKTITDDTKLIHYVGVTKPWNDWTNYPCQNYFNEAYQASCWNDVAFIP
ATNEKQYQVKYQHAKKNGDTFNAFIYFIKFKLNKYKRKLFG