Protein Info for OH686_23650 in Pseudomonas sp. S08-1

Annotation: 4-hydroxy-tetrahydrodipicolinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00701: DHDPS
  • amino acids 4 to 284 (281 residues), 199.1 bits, E=3.4e-63
• TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase
  • amino acids 7 to 285 (279 residues), 237 bits, E=9.9e-75

Best Hits

Swiss-Prot: 35% identical to DAPA_OCEIH: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 73% identity to pmk:MDS_3701)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• dipicolinate biosynthesis (3/4 steps found)
• L-lysine biosynthesis II (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52, 4.3.3.7

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Protein Sequence (288 amino acids)

>OH686_23650 4-hydroxy-tetrahydrodipicolinate synthase (Pseudomonas sp. S08-1)
MSDFRGIWVALVTPFRAGEIDFAALHGLVGRLLEEGVSGLVICGSTGEAAALSQEEQLAV
LDAVLQWVPQQQVIMGLAGNNQRELLALQQQIQLRAPAGLLVPAPYYVRPSQQGLEAFFQ
TVADATSVPLVLYDIPYRTGVRIERETLRRIVRHPRIVAIKDCGGDPETTMALIADGNVQ
VLAGEDLQIFGTLCLGAAGAISASAHIRADLYVLMQRQIEQGELVAARRTFYRLLPWMQL
AFVEPNPAVIKGALAVQDRIAHELREPLMPCTSGTLERVREVLAALAD